PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa010526
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 308aa    MW: 33395.1 Da    PI: 8.3741
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-13562PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-3945106263
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                ke+a++cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Lsa010526  45 KEAAINCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 106
                67899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-283997IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3348103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.10649103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MDTAHWPQEI AMKPMEEMVV QNATNSCSKP SSNSSSLERR ARPQKEAAIN CPRCNSTNTK  60
FCYYNNYSLS QPRYFCKTCR RYWTEGGSLR NVPVGGGSRK NKRSSSSISS HSSMSKKLPD  120
LVVPPAANPV LSQNPRMHHE HGQDLNLGFP STNDFKTISE LIQVPNFDGT KNTTSASGTT  180
TSSANLSALE LLTGMTTRGM MNSFMPIPVP DPNSVYSSSG QLMIPMPEFK IPSLSFSLDG  240
MGGNGGGGTY GSSLHDSSSG RLLFPFEDLK TSSATTTTHD GHHSVEQNRD QNGDTNGFWT  300
GMLGGGSW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039445.11e-115F-box family protein isoform 1
TrEMBLA0A142IXE11e-161A0A142IXE1_CHRMO; DOF transcription factor 8 (Fragment)
STRINGVIT_02s0025g02250.t011e-113(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.14e-51Dof family protein